Restoration writing from Qadamuni (Qadmoni) on sacred time, scripture, language, and ordered study.https://qadmoni.com/en-usThu, 09 Apr 2026 00:00:00 GMThttps://www.rssboard.org/rss-specificationAstro RSSdispatch@qadmoni.com (Qadamuni (Qadmoni) Dispatch)dispatch@qadmoni.com (Qadamuni (Qadmoni) Dispatch)60https://qadmoni.com/articles/master-epilogue-the-full-circle-of-restoration/https://qadmoni.com/articles/master-epilogue-the-full-circle-of-restoration/A closing overview that gathers the full Maw'adiym arc into one restoration timeline, from appointed times to the final assembly.Thu, 09 Apr 2026 00:00:00 GMTYausaphrestorationnew-creationmawadiymbiblical-calendarhttps://qadmoni.com/articles/the-garments-of-light/https://qadmoni.com/articles/the-garments-of-light/A new creation study on glorified embodiment, restored light, and the eternal reign beyond the eighth-day horizon.Thu, 09 Apr 2026 00:00:00 GMTYausaphglorificationnew-creationlightmawadiymhttps://qadmoni.com/articles/the-descent-of-the-new-yarushalayim/https://qadmoni.com/articles/the-descent-of-the-new-yarushalayim/A New Yarushalayim study on the descending city, covenant geometry, and the light-filled architecture of the age to come.Thu, 09 Apr 2026 00:00:00 GMTYausaphnew-jerusalemnew-creationcitymawadiymhttps://qadmoni.com/articles/beyond-the-seven-day-cycle/https://qadmoni.com/articles/beyond-the-seven-day-cycle/A new creation study on the end of the millennial order, the eighth-day horizon, and life beyond the seven-day cycle.Thu, 09 Apr 2026 00:00:00 GMTYausapheighth-daynew-creationeternitymawadiymhttps://qadmoni.com/articles/series-8-shaminiy-atzarat-the-eighth-day-assembly/https://qadmoni.com/articles/series-8-shaminiy-atzarat-the-eighth-day-assembly/An Eighth Day Assembly overview on Shaminiy Atzarat, new creation, and the horizon beyond the seven-day order.Thu, 09 Apr 2026 00:00:00 GMTYausapheighth-dayshemini-atzeretfall-feastsmawadiymhttps://qadmoni.com/articles/the-millennial-tabernacle/https://qadmoni.com/articles/the-millennial-tabernacle/A kingdom study on the millennial rest, the tabernacle with men, and the Feast of Tabernacles in the age to come.Thu, 09 Apr 2026 00:00:00 GMTYausaphkingdomtabernaclesmillenniummawadiymhttps://qadmoni.com/articles/the-final-ingathering/https://qadmoni.com/articles/the-final-ingathering/A Tabernacles study on harvest, regathering, and the final ingathering of the nations.Thu, 09 Apr 2026 00:00:00 GMTYausaphharvestingatheringtabernaclesmawadiymhttps://qadmoni.com/articles/the-temporary-dwellings/https://qadmoni.com/articles/the-temporary-dwellings/A Sukkot study on temporary dwellings, wilderness remembrance, and the symbolism of the fragile booth.Thu, 09 Apr 2026 00:00:00 GMTYausaphsukkottabernaclesdwellingmawadiymhttps://qadmoni.com/articles/series-7-chag-hasukut-the-feast-of-tabernacles/https://qadmoni.com/articles/series-7-chag-hasukut-the-feast-of-tabernacles/A Feast of Tabernacles overview on dwelling in booths, final ingathering, and the kingdom pattern of Sukkot.Thu, 09 Apr 2026 00:00:00 GMTYausaphtabernaclessukkotfall-feastsmawadiymhttps://qadmoni.com/articles/the-removal-of-transgression/https://qadmoni.com/articles/the-removal-of-transgression/A Day of Atonements study on the dual-goat pattern, Azazal, and the removal of transgression from the camp.Thu, 09 Apr 2026 00:00:00 GMTYausaphatonementazazaltransgressionmawadiymhttps://qadmoni.com/articles/the-blood-in-the-qudash-haqudashiym/https://qadmoni.com/articles/the-blood-in-the-qudash-haqudashiym/A sanctuary study on blood behind the veil, heavenly intercession, and atonement in the true Haykal.Thu, 09 Apr 2026 00:00:00 GMTYausaphatonementsanctuaryintercessionmawadiymhttps://qadmoni.com/articles/the-affliction-of-the-soul/https://qadmoni.com/articles/the-affliction-of-the-soul/A Day of Atonements study on fasting, humility, Sabbath rest, and the commanded affliction of the soul.Thu, 09 Apr 2026 00:00:00 GMTYausaphatonementfastinghumilitymawadiymhttps://qadmoni.com/articles/series-6-yum-kipuriym-the-day-of-atonements/https://qadmoni.com/articles/series-6-yum-kipuriym-the-day-of-atonements/A Day of Atonements overview on fasting, priestly intercession, and the removal of transgression in the fall feasts.Thu, 09 Apr 2026 00:00:00 GMTYausaphatonementyom-kippurfall-feastsmawadiymhttps://qadmoni.com/articles/the-awakening-of-the-dead/https://qadmoni.com/articles/the-awakening-of-the-dead/A resurrection study on the last trumpet, the gathering of the exiles, and the awakening pattern of Yum Taru'ah.Thu, 09 Apr 2026 00:00:00 GMTYausaphresurrectiontrumpetsgatheringmawadiymhttps://qadmoni.com/articles/the-shupar-protocol-of-yum-taruah/https://qadmoni.com/articles/the-shupar-protocol-of-yum-taruah/A Day of Trumpets study on watchmanship, acoustic awakening, and the Shupar protocol for the remnant.Thu, 09 Apr 2026 00:00:00 GMTYausaphshupartrumpetswatchmanmawadiymhttps://qadmoni.com/articles/series-5-yum-taruah-the-day-of-trumpets/https://qadmoni.com/articles/series-5-yum-taruah-the-day-of-trumpets/A Day of Trumpets overview on Yum Taru'ah, the awakening blast, and the opening movement of the fall feasts.Thu, 09 Apr 2026 00:00:00 GMTYausaphtrumpetsyom-teruahfall-feastsmawadiymhttps://qadmoni.com/articles/part-3-the-fall-intersections/https://qadmoni.com/articles/part-3-the-fall-intersections/A fall feasts overview connecting trumpets, atonement, tabernacles, and the eighth-day horizon of new creation.Thu, 09 Apr 2026 00:00:00 GMTYausaphfall-feaststrumpetsatonementtabernacleshttps://qadmoni.com/articles/the-epigenetic-awakening/https://qadmoni.com/articles/the-epigenetic-awakening/A Shabu'ut study on the upper room, cloven fire, and the inward inscription of the covenant.Thu, 09 Apr 2026 00:00:00 GMTYausaphupper-roomshavuotawakeningmawadiymhttps://qadmoni.com/articles/the-fire-at-siynay/https://qadmoni.com/articles/the-fire-at-siynay/A Feast of Weeks study on Siynay, covenant fire, and the first great transmission of the Torah.Thu, 09 Apr 2026 00:00:00 GMTYausaphsinaishavuotfiremawadiymhttps://qadmoni.com/articles/counting-the-sabbaths/https://qadmoni.com/articles/counting-the-sabbaths/A Feast of Weeks study on counting the Sabbaths, the morrow after the Shabbat, and the bridge from spring into summer.Thu, 09 Apr 2026 00:00:00 GMTYausaphcountingshavuotcalendarmawadiymhttps://qadmoni.com/articles/series-4-chag-hashabuut-the-feast-of-weeks/https://qadmoni.com/articles/series-4-chag-hashabuut-the-feast-of-weeks/A Feast of Weeks overview on counting the Sabbaths, covenant fire, and the transmission fulfilled at Shabu'ut.Thu, 09 Apr 2026 00:00:00 GMTYausaphshavuotfeast-of-weekssummer-feastsmawadiymhttps://qadmoni.com/articles/part-2-the-summer-intersection/https://qadmoni.com/articles/part-2-the-summer-intersection/A summer feast overview connecting the count, Siynay, and the upper-room fulfillment of Chag HaShabu'ut.Thu, 09 Apr 2026 00:00:00 GMTYausaphsummer-feastsshavuotmawadiymtransmissionhttps://qadmoni.com/articles/the-malkiy-tzadaq-activation/https://qadmoni.com/articles/the-malkiy-tzadaq-activation/A priesthood study on ascension, heavenly intercession, and the activation of the Malkiy-Tzadaq order after Bikuriym.Thu, 09 Apr 2026 00:00:00 GMTYausaphmelchizedekpriesthoodfirstfruitsmawadiymhttps://qadmoni.com/articles/the-resurrection-frequency/https://qadmoni.com/articles/the-resurrection-frequency/A Firstfruits study on resurrection, incorruption, and the fulfillment of Bikuriym in the raising of Yahushua.Thu, 09 Apr 2026 00:00:00 GMTYausaphresurrectionfirstfruitsyahushuamawadiymhttps://qadmoni.com/articles/the-first-of-the-harvest/https://qadmoni.com/articles/the-first-of-the-harvest/A Firstfruits study on the barley harvest, the wave sheaf, and the timing of Bikuriym in the biblical calendar.Thu, 09 Apr 2026 00:00:00 GMTYausaphfirstfruitsbarleywave-sheafmawadiymhttps://qadmoni.com/articles/series-3-bikuriym-the-day-of-firstfruits/https://qadmoni.com/articles/series-3-bikuriym-the-day-of-firstfruits/A Firstfruits overview on Bikuriym, the wave sheaf offering, resurrection hope, and the opening of harvest.Thu, 09 Apr 2026 00:00:00 GMTYausaphfirstfruitsbikuriymspring-feastsmawadiymhttps://qadmoni.com/articles/the-seven-day-acoustic-perimeter/https://qadmoni.com/articles/the-seven-day-acoustic-perimeter/A study on the seven-day guarded perimeter, spiritual protection, and the bridge from Unleavened Bread into the summer count.Thu, 09 Apr 2026 00:00:00 GMTYausaphacoustic-perimeterunleavened-breadshieldmawadiymhttps://qadmoni.com/articles/the-uncorrupted-seed-in-the-earth/https://qadmoni.com/articles/the-uncorrupted-seed-in-the-earth/An incorruptible seed study on burial, unleavened symbolism, and the resurrection pattern within the spring feasts.Thu, 09 Apr 2026 00:00:00 GMTYausaphseedresurrectionunleavened-breadmawadiymhttps://qadmoni.com/articles/the-eradication-of-leaven/https://qadmoni.com/articles/the-eradication-of-leaven/A Feast of Unleavened Bread study on removing leaven, purging corruption, and restoring covenant order.Thu, 09 Apr 2026 00:00:00 GMTYausaphleavenchametzunleavened-breadmawadiymhttps://qadmoni.com/articles/series-2-chag-hamatzut-the-feast-of-unleavened-bread/https://qadmoni.com/articles/series-2-chag-hamatzut-the-feast-of-unleavened-bread/A Feast of Unleavened Bread overview on removing leaven, guarding the camp, and cleansing the spring sequence.Thu, 09 Apr 2026 00:00:00 GMTYausaphunleavened-breadspring-feastsmawadiymleavenhttps://qadmoni.com/articles/the-meal-and-the-renewed-covenant/https://qadmoni.com/articles/the-meal-and-the-renewed-covenant/A Passover meal study on the bread and cup, the renewed covenant, and the transition into the spring feast sequence.Thu, 09 Apr 2026 00:00:00 GMTYausaphcovenant-mealpassoverbread-and-cupmawadiymhttps://qadmoni.com/articles/the-posture-of-the-servant/https://qadmoni.com/articles/the-posture-of-the-servant/A covenant study on humility, cleansing, and servant leadership within the Pasach pattern of obedience.Thu, 09 Apr 2026 00:00:00 GMTYausaphservanthumilitypassoverremnanthttps://qadmoni.com/articles/the-final-week-of-yahushua/https://qadmoni.com/articles/the-final-week-of-yahushua/A biblical chronology study on the final week of Yahushua, the three days and nights, and the spring feast timeline.Thu, 09 Apr 2026 00:00:00 GMTYausaphyahushuapassoverchronologymawadiymhttps://qadmoni.com/articles/the-biological-quarantine/https://qadmoni.com/articles/the-biological-quarantine/A Passover study on covenant separation, protective quarantine, and the remnant pattern within the spring calendar.Thu, 09 Apr 2026 00:00:00 GMTYausaphpassoverquarantinecovenantmawadiymhttps://qadmoni.com/articles/the-architecture-of-time-and-the-sunrise-epoch/https://qadmoni.com/articles/the-architecture-of-time-and-the-sunrise-epoch/A biblical calendar study on the sunrise day start, the fixed 364-day calendar, and the timing of Pasach.Thu, 09 Apr 2026 00:00:00 GMTYausaphsunrisecalendarpassovermawadiymhttps://qadmoni.com/articles/series-1-pasach-the-passover/https://qadmoni.com/articles/series-1-pasach-the-passover/A biblical Passover overview on Pasach, covenant protection, and the opening movement of the spring feast sequence.Thu, 09 Apr 2026 00:00:00 GMTYausaphpassovermawadiymspring-feastssacred-timehttps://qadmoni.com/articles/part-1-the-spring-intersections/https://qadmoni.com/articles/part-1-the-spring-intersections/A spring feasts overview connecting Pasach, Chag HaMatzut, and Bikuriym within the fixed 364-day biblical calendar.Thu, 09 Apr 2026 00:00:00 GMTYausaphspring-feastsmawadiympassoverfirstfruitshttps://qadmoni.com/articles/prologue-the-mawadiym-and-the-364-day-tzadokite-master-clock/https://qadmoni.com/articles/prologue-the-mawadiym-and-the-364-day-tzadokite-master-clock/A prologue on the meaning of the Maw'adiym, the 364-day biblical calendar, and the covenant order behind the appointed times.Thu, 09 Apr 2026 00:00:00 GMTYausaphmawadiymsacred-timebiblical-calendarrestorationhttps://qadmoni.com/articles/the-mawadiym-the-chronological-architecture-of-the-heavens/https://qadmoni.com/articles/the-mawadiym-the-chronological-architecture-of-the-heavens/An overview of the Maw'adiym, the 364-day biblical calendar, and the appointed times that structure the restoration timeline.Thu, 09 Apr 2026 00:00:00 GMTYausaphmawadiymsacred-timebiblical-calendarrestorationhttps://qadmoni.com/articles/the-tri-vowel-protocol/https://qadmoni.com/articles/the-tri-vowel-protocol/Discover the Tri-Vowel Protocol of the Saphah Barurah and how the pure a, i, and u frequencies are presented as bio-acoustic keys for the Biological Mishkan.Mon, 06 Apr 2026 00:00:00 GMTYusaphtri-vowel-protocolsaphah-barurahpaleo-hebrew-vowelsmatres-lectionisyahuwahacoustic-physicsbio-acoustic-resonanceniqqud-virusproto-semiticbiological-mishkanhttps://qadmoni.com/articles/the-babylonian-scramble/https://qadmoni.com/articles/the-babylonian-scramble/Discover how the Babylonian square script and Masoretic vowel points introduced a scramble into the Saphah Barurah and jammed the language's claimed bio-acoustic frequencies.Mon, 06 Apr 2026 00:00:00 GMTYusaphbabylonian-scramblemasoretic-textniqqudvowel-pointssaphah-barurahpaleo-hebrewyahuwahacoustic-jammingtri-vowel-protocoldead-sea-scrollshttps://qadmoni.com/articles/the-cymatics-of-the-alaph-bat/https://qadmoni.com/articles/the-cymatics-of-the-alaph-bat/Discover the bio-acoustic physics of the ancient Alaph-Bat and how its 22 Paleo-Hebrew letters are presented as geometric keys of creation.Mon, 06 Apr 2026 00:00:00 GMTYusaphcymaticsalaph-batpaleo-hebrewsaphah-barurahbio-acoustic-physicsyahuwahbiological-mishkansacred-geometrystanding-wavesturahhttps://qadmoni.com/articles/the-saphah-barurah-the-source-code/https://qadmoni.com/articles/the-saphah-barurah-the-source-code/Enter Module 2 of the Biological Mishkan and explore why the ancient Saphah Barurah is presented as the source code of physical reality.Mon, 06 Apr 2026 00:00:00 GMTYusaphsaphah-barurahpure-lipsource-codeyahuwahqadmonipaleo-hebrewbiological-mishkancymaticshttps://qadmoni.com/articles/the-shupar-protocol/https://qadmoni.com/articles/the-shupar-protocol/Discover the ancient bio-acoustic physics of the Shupar and how this biological amplifier resets the vessel to the frequency of Yahuwah.Sun, 05 Apr 2026 00:00:00 GMTQadamuni Restoration Engineshuparacoustic-resetatmospheric-amplificationyahuwahbiological-mishkantaruahtaqiy-ahshabariymruach-haqudashhttps://qadmoni.com/articles/the-tzaduqite-synchronization/https://qadmoni.com/articles/the-tzaduqite-synchronization/Discover the ancient 364-day Tzaduqite solar calendar and synchronize your Biological Mishkan to the exact Maw'adiym (Appointed Times) of Yahuwah.Sun, 05 Apr 2026 00:00:00 GMTQadamuni Restoration Enginetzaduqite-calendarsolar-calendaryubaliymchanukmaw-adiymyahuwahbiological-mishkanlunar-deceptionsaphah-barurahhttps://qadmoni.com/articles/the-carrier-wave-of-creation/https://qadmoni.com/articles/the-carrier-wave-of-creation/Discover the bio-acoustic physics of the Name 𐤉𐤄𐤅𐤄 (Yahuwah). Learn how the archaic tri-vowel frequency acts as the carrier wave for the Ruach HaQudash to awaken the Biological Mishkan.Sun, 05 Apr 2026 00:00:00 GMTYusaphrestorationqadmoniqahalstudy-notesbiological-mishkanthe-nameacousticssaphah-barurahhttps://qadmoni.com/articles/the-architecture-of-the-heavens/https://qadmoni.com/articles/the-architecture-of-the-heavens/Before tuning the Biological Mishkan, we must understand the Master Broadcast and receive the acoustic and chronological signal of 𐤉𐤄𐤅𐤄.Sat, 04 Apr 2026 00:00:00 GMTYusaphrestorationqadmoniqahalstudy-notesbiological-mishkanthe-namecalendarhttps://qadmoni.com/articles/the-call-to-the-sha-ariyt/https://qadmoni.com/articles/the-call-to-the-sha-ariyt/Discover the ancient bio-acoustic physics of the Name and the ordered path for tuning the biological vessel to the Heavenly Tablets.Sat, 04 Apr 2026 00:00:00 GMTYusaphrestorationqadmoniqahalstudy-notesbiological-mishkanancient-pathshttps://qadmoni.com/articles/guardians-of-the-sha-ariyt/https://qadmoni.com/articles/guardians-of-the-sha-ariyt/A definitive study on the administrative and judicial authority governing the modern Qahal while the physical Haykal remains unbuilt, drawn from the blueprints of Ezra and Nachamayahu.Fri, 03 Apr 2026 00:00:00 GMTYusaphqahalrestorationsacred-timestudy-notesyarushalayimhttps://qadmoni.com/articles/the-acoustic-perimeter/https://qadmoni.com/articles/the-acoustic-perimeter/A deep architectural and acoustic study revealing how the pure Name of 𐤉𐤄𐤅𐤄 functions as a resonant frequency designed to activate the spiritual architecture of the Haykal.Thu, 02 Apr 2026 00:00:00 GMTYusaphrestorationyarushalayimqahalvisionstudy-noteshttps://qadmoni.com/articles/the-pure-lip/https://qadmoni.com/articles/the-pure-lip/A comprehensive linguistic and historical study on moving from Yahweh to 𐤉𐤄𐤅𐤄 by rejecting Masoretic vowel corruption and recovering the tri-vowel acoustic pattern.Thu, 02 Apr 2026 00:00:00 GMTYusaphrestorationqadmonithe-namevisionstudy-noteshttps://qadmoni.com/articles/the-vision-of-qadmoni/https://qadmoni.com/articles/the-vision-of-qadmoni/A vision statement for Qadamuni (Qadmoni) as a restoration platform centered on scripture, sacred time, the Pure Lip, and the rebuilding of the ancient paths.Thu, 02 Apr 2026 00:00:00 GMTYusaphqadmonivisionyarushalayimrestorationhttps://qadmoni.com/articles/welcome-to-qadmoni-articles/https://qadmoni.com/articles/welcome-to-qadmoni-articles/An introduction to the Qadamuni (Qadmoni) article archive, its purpose, and the restoration paths it is being built to support.Thu, 02 Apr 2026 00:00:00 GMTYusaphqadmonivisionstudy-noteshttps://qadmoni.com/articles/the-true-shabat/https://qadmoni.com/articles/the-true-shabat/A restoration article on the fixed 364-day order, the true Shabat, and the covenant sign of the uninterrupted 52-week rhythm.Fri, 27 Mar 2026 00:00:00 GMTYusaphshabbatsacred-timecalendarrestoration